PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011081575.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 311aa    MW: 35076 Da    PI: 6.0083
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011081575.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.61e-38481471100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++ rkCa+dC+lapyfp++++++f n+h+lFG+sn++k++++l++  r++am+++++++eara dPv G++++i++l+qq++ +kael+
  XP_011081575.1  48 ACAACKYQLRKCASDCILAPYFPHDRQRQFLNAHRLFGVSNIVKIIRHLDPPARDHAMRTIIFQSEARAADPVGGCYRIIRELEQQISLVKAELE 142
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  XP_011081575.1 143 IVLHQ 147
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.547148IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-3648143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MQSNNIIIPN NLNKRTNTCT PSRKNNNNNI TSINTIPHHR SHVSTTQACA ACKYQLRKCA  60
SDCILAPYFP HDRQRQFLNA HRLFGVSNIV KIIRHLDPPA RDHAMRTIIF QSEARAADPV  120
GGCYRIIREL EQQISLVKAE LEIVLHQLTL CRAAAARQVE STPLSSISGE LAWSCNEEAK  180
WGGDCGENDD DEVVVINDVN LWNCMHENTN GYAESISSSF AAQDHHRRSL SFDECNHDMK  240
AILDHLSGDD HDGTHEEFKF DSHGNILPSK NAILTEENPT FKEEDEPLSY IQDHHDLKAA  300
ATFFTLTNCD F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081575.10.0PREDICTED: LOB domain-containing protein 22-like
TrEMBLA0A022S0S31e-105A0A022S0S3_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-50LOB domain-containing protein 22